UBE2L3 Antibody - C-terminal region (ARP90458_P050)

Catalog No: ARP90458_P050

Host: Rabbit
Target Name: UBE2L3
Sample Tissue: Mouse Kidney lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse UBE2L3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-UBE2L3 (ARP90458_P050) antibody is Catalog # AAP90458

Target Info

• Gene Symbol: UBE2L3
• Gene Full Name: ubiquitin-conjugating enzyme E2L 3
• Alias Symbols: UbcM4, Ubce7, C79827
• NCBI Gene Id: 22195
• Protein Name: ubiquitin-conjugating enzyme E2 L3
• Description of Target: Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-lived and abnormal proteins. Down-regulated during the S-phase it is involved in progression through the cell cycle. Regulates nuclear hormone receptors transcriptional activity. May play a role in myelopoiesis.
• Uniprot ID: P68037
• Protein Accession #: NP_033482.1
• Nucleotide Accession #: NM_009456.2
• Protein Size (# AA): 154
• Molecular Weight: 16 kDa