SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45904_P050
Price: $0.00
SKU
ARP45904_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

TSPEAR Antibody - C-terminal region (ARP45904_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-TSPEAR (ARP45904_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TSEAR
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceDog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: YDWEFFSVGPYSFLVVANTFNGTSTKVHSHLYIRLLGSFQLFQSFPTFGA
Concentration0.5 mg/ml
Blocking PeptideFor anti-TSPEAR (ARP45904_P050) antibody is Catalog # AAP45904
Gene SymbolTSPEAR
Gene Full Namethrombospondin type laminin G domain and EAR repeats
Alias SymbolsDFNB98, ECTD14, TSP-EAR, C21orf29
NCBI Gene Id54084
Protein Namethrombospondin-type laminin G domain and EAR repeat-containing protein
Description of TargetThis gene encodes a protein that contains a N-terminal thrombospondin-type laminin G domain and several tandem arranged epilepsy-associated repeats (EARs). A mutation in this gene is the cause of autosomal recessive deafness-98. Alternate splicing results in multiple transcript variants.
Uniprot IDQ8WU66
Protein Accession #NP_659428
Protein Size (# AA)669
Molecular Weight73kDa
  1. What is the species homology for "TSPEAR Antibody - C-terminal region (ARP45904_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "TSPEAR Antibody - C-terminal region (ARP45904_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TSPEAR Antibody - C-terminal region (ARP45904_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TSPEAR Antibody - C-terminal region (ARP45904_P050)"?

    This target may also be called "DFNB98, ECTD14, TSP-EAR, C21orf29" in publications.

  5. What is the shipping cost for "TSPEAR Antibody - C-terminal region (ARP45904_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "TSPEAR Antibody - C-terminal region (ARP45904_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TSPEAR Antibody - C-terminal region (ARP45904_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "73kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TSPEAR Antibody - C-terminal region (ARP45904_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TSPEAR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TSPEAR"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TSPEAR"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TSPEAR"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TSPEAR"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TSPEAR"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:TSPEAR Antibody - C-terminal region (ARP45904_P050)
Your Rating