TSN Antibody - middle region (ARP63474_P050)

Catalog No: ARP63474_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-TSN Antibody
Titration: 1.0 ug/ml
Positive Control: 293T Whole CellThere is BioGPS gene expression data showing that TSN is expressed in HEK293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: LVTREAVTEILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TSN (ARP63474_P050) antibody is Catalog # AAP63474
• Sample Type Confirmation:

  There is BioGPS gene expression data showing that TSN is expressed in HEK293T

Target Info

• Gene Symbol: TSN
• Gene Full Name: Translin
• Alias Symbols: C3PO, RCHF1, TBRBP, TRSLN, BCLF-1, REHF-1
• NCBI Gene Id: 7247
• Protein Name: Translin
• Description of Target: This gene encodes a DNA-binding protein which specifically recognizes conserved target sequences at the breakpoint junction of chromosomal translocations. Translin polypeptides form a multimeric structure that is responsible for its DNA-binding activity. Recombination-associated motifs and translin-binding sites are present at recombination hotspots and may serve as indicators of breakpoints in genes which are fused by translocations. These binding activities may play a crucial role in chromosomal translocation in lymphoid neoplasms.
• Uniprot ID: Q15631
• Protein Accession #: NP_004613
• Nucleotide Accession #: NM_004622
• Protein Size (# AA): 228
• Molecular Weight: 25kDa
• Protein Interactions: UBC; WDR12; NSUN2; TSNAX; TBCD; SHMT1; PPP3CA; PFDN1; NRD1; ETF1; ATP6V1C1; SETSIP; FAM129B; P3H1; ELAC2; SNX6; MYC; GIT2; TSN; EIF4A3; MAGOH; UBA6; VPS29; UCHL3; TTC4; ZBTB18; PPP1R15A; HCVgp1;