TRIM58 Antibody - N-terminal region (ARP34533_P050)

Catalog No: ARP34533_P050

Host: Rabbit
Target Name: TRI58
Sample Type: MCF7 Whole Cell
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen for Anti-TRIM58 antibody is: synthetic peptide directed towards the N-terminal region of Human TRI58
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 79%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 91%; Rabbit: 86%; Rat: 91%
• Peptide Sequence: Synthetic peptide located within the following region: HRTHRTAPLQEAAGSYQVKLQMALELMRKELEDALTQEANVGKKTVIWKE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For Anti-TRIM58 antibody is Catalog # AAP34533
• Reference: N/A

Target Info

• Gene Symbol: TRIM58
• Gene Full Name: tripartite motif containing 58
• Alias Symbols: BIA2
• NCBI Gene Id: 25893
• Protein Name: Tripartite motif-containing protein 58
• Uniprot ID: Q8NG06
• Protein Size (# AA): 486
• Molecular Weight: 53 kDa
• Protein Interactions: DYNC2LI1; TRIM58; UBE2D3; UBC; DYNC1LI2; DYNC1I1; DYNC1H1;