TMEM63A Antibody - N-terminal region (ARP40784_P050)

Catalog No: ARP40784_P050

WB Suggested Anti-TMEM63A Antibody Titration: 0.2-1 ug/ml
Positive Control: 293T cell lysate

Host: Rabbit
Target: TMEM63A
Positive control (+): Human stomach (ST)
Negative control (-): Human liver (LI)
Antibody concentration: 0.5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM63A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%; Yeast: 83%
• Peptide Sequence: Synthetic peptide located within the following region: MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-TMEM63A (ARP40784_P050) antibody is Catalog # AAP40784 (Previous Catalog # AAPY01036)
• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Target Info

• Gene Symbol: TMEM63A
• Gene Full Name: Transmembrane protein 63A
• Alias Symbols: HLD19, KIAA0792
• NCBI Gene Id: 9725
• Protein Name: Transmembrane protein 63A
• Description of Target: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.
• Uniprot ID: O94886
• Protein Accession #: NP_055513
• Nucleotide Accession #: NM_014698
• Protein Size (# AA): 807
• Molecular Weight: 89kDa
• Protein Interactions: UBC;