TAF1A Antibody - N-terminal region (P100801_T100)

Catalog No: P100801_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: TAF(I)48
Sample Type: Raji Cell
Antibody Dilution: 1.0ug/mlTAF1A is supported by BioGPS gene expression data to be expressed in Raji

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1A
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Horse: 85%; Human: 100%; Mouse: 85%; Pig: 78%; Rabbit: 85%; Rat: 78%
• Peptide Sequence: Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-TAF1A (P100801_T100) antibody is Catalog # AAP31143 (Previous Catalog # AAPP01882)
• Sample Type Confirmation:

  TAF1A is supported by BioGPS gene expression data to be expressed in Raji

• Subunit: A

Target Info

• Reference: Di Pietro, C., et al., (2000) Cytogenet. Cell Genet. 89 (1-2) 133-136.
• Gene Symbol: TAF1A
• Gene Full Name: TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
• Alias Symbols: SL1, RAFI48, TAFI48, MGC:17061
• NCBI Gene Id: 9015
• Protein Name: TATA box-binding protein-associated factor RNA polymerase I subunit A
• Description of Target: Initiation of transcription by RNA polymerase I requires the formation of a complex composed of the TATA-binding protein (TBP) and three TBP-associated factors (TAFs) specific for RNA polymerase I. This complex, also known as SL1, binds to the core promoter of ribosomal RNA genes to position the polymerase properly and acts as a channel for regulatory signals. This gene encodes the smallest SL1-specific TAF. Two transcripts encoding different isoforms have been identified.
• Uniprot ID: Q15573
• Protein Accession #: NP_005672
• Nucleotide Accession #: NM_005681
• Protein Size (# AA): 450
• Molecular Weight: 53kDa
• Protein Interactions: C11orf57; JMJD6; TBP; Taf1c; Taf1b; BKRF1; UBC; TAF12; TAF1D; HIST1H4A; HIST1H3A; HIST2H2BE; HIST2H2AC; ESR1; SET; TAF1A; RUNX2; TP53; CD3EAP; HIST4H4; HIST3H3; ANP32A; UBTF; RRN3; MYC;