Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SUZ12 Antibody - C-terminal region (ARP39190_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP39190_P050-FITC Conjugated

ARP39190_P050-HRP Conjugated

ARP39190_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Suppressor of zeste 12 homolog (Drosophila)
NCBI Gene Id:
Protein Name:
Polycomb protein SUZ12
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-271325 from Santa Cruz Biotechnology.
Description of Target:
A chromosomal aberration involving SUZ12 may be a cause of endometrial stromal tumors. Translocation t (7;17)(p15;q21) with JAZF1 generates the JAZF1-SUZ12 oncogene consisting of the N-terminus part of JAZF1 and the C-terminus part of SUZ12. It is frequently found in all cases of endometrial stromal tumors, except in endometrial stromal sarcomas, where it is rarer.This zinc finger gene has been identified at the breakpoints of a recurrent chromosomal translocation reported in endometrial stromal sarcoma. Recombination of these breakpoints results in the fusion of this gene and JAZF1. The protein encoded by this gene contains a zinc finger domain in the C terminus of the coding region. The specific function of this gene has not yet been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SUZ12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SUZ12.
The immunogen is a synthetic peptide directed towards the C terminal region of human SUZ12
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93%
Complete computational species homology data:
Anti-SUZ12 (ARP39190_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-SUZ12 (ARP39190_P050) antibody is Catalog # AAP39190 (Previous Catalog # AAPP21295)
Printable datasheet for anti-SUZ12 (ARP39190_P050) antibody
Sample Type Confirmation:

SUZ12 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Li,H., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (50), 20001-20006

De Cegli, R. et al. Reverse engineering a mouse embryonic stem cell-specific transcriptional network reveals a new modulator of neuronal differentiation. Nucleic Acids Res. 41, 711-26 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23180766

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...