STC2 Antibody - C-terminal region (ARP64151_P050)

Catalog No: ARP64151_P050

WB Suggested Anti-STC2 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: HHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-STC2 (ARP64151_P050) antibody is Catalog # AAP64151

Target Info

• Gene Symbol: STC2
• Gene Full Name: Stanniocalcin 2
• Alias Symbols: STC-2, STCRP
• NCBI Gene Id: 8614
• Protein Name: Stanniocalcin-2
• Description of Target: This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The encoded protein has 10 of its 15 cysteine residues conserved among stanniocalcin family members and is phosphorylated by casein kinase 2 exclusively on its serine residues. Its C-terminus contains a cluster of histidine residues which may interact with metal ions. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Constitutive overexpression of human stanniocalcin 2 in mice resulted in pre- and postnatal growth restriction, reduced bone and skeletal muscle growth, and organomegaly. Expression of this gene is induced by estrogen and altered in some breast cancers.
• Uniprot ID: O76061
• Protein Accession #: NP_003705
• Nucleotide Accession #: NM_003714
• Protein Size (# AA): 302
• Molecular Weight: 31kDa
• Protein Interactions: UBC; ELAVL1; POLR2C; POLR3F; ARHGEF40; EIF2B3; CARHSP1; PEBP1; PPP1R8; AIFM1; PTN; ADAM11; ARRB2;