ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP37719_P050
Price: $0.00
SKU
ARP37719_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-SSX2 (ARP37719_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SSX2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: HRWSSQNTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRE
Concentration0.5 mg/ml
Blocking PeptideFor anti-SSX2 (ARP37719_P050) antibody is Catalog # AAP37719 (Previous Catalog # AAPP08802)
ReferenceFernebro,J., et al., (2006) Int. J. Cancer 118 (5), 1165-1172
Publications

Jung, V. et al. Yeast-based identification of prostate tumor antigens provides an effective vaccine platform. Anticancer Res. 30, 895-902 (2010). 20393012

Gene SymbolSSX2
Gene Full NameSynovial sarcoma, X breakpoint 2
Alias SymbolsSSX, HD21, CT5.2, CT5.2A, HOM-MEL-40
NCBI Gene Id6757
Protein NameProtein SSX2
Description of TargetSSX2 belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene.The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene.
Uniprot IDQ16385-2
Protein Accession #NP_003138
Nucleotide Accession #NM_003147
Protein Size (# AA)223
Molecular Weight25kDa
Protein InteractionsKRT40; SSX2IP; RAB3IP; SYCE1; ZMIZ2; MAGEC2; AKAP9; ZBED1; TAX1BP1; BLZF1; SUZ12; EED; SMARCA5; TLE1; SMARCA2; HDAC2; HDAC1; EZH2; ATF2; RNF2;
  1. What is the species homology for "SSX2 Antibody - C-terminal region (ARP37719_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "SSX2 Antibody - C-terminal region (ARP37719_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SSX2 Antibody - C-terminal region (ARP37719_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SSX2 Antibody - C-terminal region (ARP37719_P050)"?

    This target may also be called "SSX, HD21, CT5.2, CT5.2A, HOM-MEL-40" in publications.

  5. What is the shipping cost for "SSX2 Antibody - C-terminal region (ARP37719_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "SSX2 Antibody - C-terminal region (ARP37719_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SSX2 Antibody - C-terminal region (ARP37719_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SSX2 Antibody - C-terminal region (ARP37719_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SSX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SSX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SSX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SSX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SSX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SSX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:SSX2 Antibody - C-terminal region (ARP37719_P050)
Your Rating
We found other products you might like!