SSTR2 Antibody - middle region (ARP59561_P050)

Catalog No: ARP59561_P050

WB Suggested Anti-SSTR2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle

Host: Mouse
Target Name: SSTR2
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human, Mouse
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SSTR2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPAL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SSTR2 (ARP59561_P050) antibody is Catalog # AAP59561 (Previous Catalog # AAPP45672)

Target Info

• Gene Symbol: SSTR2
• Gene Full Name: Somatostatin receptor 2
• Alias Symbols: -
• NCBI Gene Id: 6752
• Protein Name: Somatostatin receptor type 2
• Description of Target: Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SSTR2 is a member of the superfamily of receptors having seven transmembrane segments and is expressed in highest levels in cerebrum and kidney.
• Uniprot ID: P30874
• Protein Accession #: NP_001041
• Nucleotide Accession #: NM_001050
• Protein Size (# AA): 369
• Molecular Weight: 41kDa
• Protein Interactions: APP; ELAVL1; SST; SHANK1; GNA14; SHANK2; CORT; PTPN6; PIK3R1; GNAI1;