SORBS2 Antibody - middle region (ARP88353_P050)

Catalog No: ARP88353_P050

Host: Rabbit
Target Name: SORBS2
Sample Tissue: Human A549 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SORBS2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: PPHVPPPVPPLRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SORBS2 (ARP88353_P050) antibody is Catalog # AAP88353

Target Info

• Gene Symbol: SORBS2
• Gene Full Name: sorbin and SH3 domain containing 2
• Alias Symbols: ARGBP2, PRO0618
• NCBI Gene Id: 8470
• Protein Name: sorbin and SH3 domain-containing protein 2
• Description of Target: Arg and c-Abl represent the mammalian members of the Abelson family of non-receptor protein-tyrosine kinases. They interact with the Arg/Abl binding proteins via the SH3 domains present in the carboxy end of the latter group of proteins. This gene encodes the sorbin and SH3 domain containing 2 protein. It has three C-terminal SH3 domains and an N-terminal sorbin homology (SoHo) domain that interacts with lipid raft proteins. The subcellular localization of this protein in epithelial and cardiac muscle cells suggests that it functions as an adapter protein to assemble signaling complexes in stress fibers, and that it is a potential link between Abl family kinases and the actin cytoskeleton. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: O94875-12
• Protein Accession #: NP_001139142.1
• Nucleotide Accession #: NM_001145670.1
• Protein Size (# AA): 731
• Molecular Weight: 80 kDa