Search Antibody, Protein, and ELISA Kit Solutions

SNRPD1 Antibody - N-terminal region : FITC (ARP40693_P050-FITC)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40693_P050 Unconjugated

ARP40693_P050-HRP Conjugated

ARP40693_P050-Biotin Conjugated

Gene Symbol:
SNRPD1
Official Gene Full Name:
Small nuclear ribonucleoprotein D1 polypeptide 16kDa
NCBI Gene Id:
6632
Protein Name:
Small nuclear ribonucleoprotein Sm D1
Swissprot Id:
P62314
Protein Accession #:
NP_008869
Nucleotide Accession #:
NM_006938
Alias Symbols:
SMD1, SNRPD, Sm-D1, HsT2456
Replacement Item:
This antibody may replace item sc-111571 from Santa Cruz Biotechnology.
Description of Target:
SNRPD1 is a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.This gene encodes a small nuclear ribonucleoprotein that belongs to the SNRNP core protein family. The protein may act as a charged protein scaffold to promote SNRNP assembly or strengthen SNRNP-SNRNP interactions through nonspecific electrostatic contacts with RNA.
Protein Size (# AA):
119
Molecular Weight:
13kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SNRPD1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SNRPD1.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human SNRPD1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 86%
Complete computational species homology data:
Anti-SNRPD1 (ARP40693_P050)
Peptide Sequence:
Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
CLNS1A; WWOX; ASB2; ASB1; EZH2; SUZ12; EED; RNF2; EIF5; PDHB; SCLY; FERMT2; PRPF4B; SRPK2; SRPK3; EGFR; CD81; IGSF8; NPM1; ICAM1; PAN2; VCAM1; U2AF1; ITGA4; IL7R; IFIT3; IFIT1; IFIT2; FN1; LSM3; SMURF1; EIF4A3; MAGOH; CTNNB1; ESR1; SNRPB; SNRPA1; SNRNP70;
Blocking Peptide:
For anti-SNRPD1 (ARP40693_P050-FITC) antibody is Catalog # AAP40693 (Previous Catalog # AAPP10435)
Datasheets/Manuals:
Printable datasheet for anti-SNRPD1 (ARP40693_P050-FITC) antibody
Sample Type Confirmation:

SNRPD1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
Lennerz,V., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (44), 16013-16018

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...