Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

SLC35B2 Antibody - N-terminal region : FITC (ARP66680_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP66680_P050 Unconjugated

ARP66680_P050-HRP Conjugated

ARP66680_P050-Biotin Conjugated

Gene Symbol:
SLC35B2
NCBI Gene Id:
347734
Swissprot Id:
Q8TB61-3
Alias Symbols:
SLC35B2, PAPST1, PSEC0149,
Replacement Item:
This antibody may replace item sc-243737 from Santa Cruz Biotechnology.
Description of Target:
Sulfotransferases use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen。
Protein Size (# AA):
383
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express SLC35B2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express SLC35B2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human SLC35B2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LLVQYFRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; CLN3;
Blocking Peptide:
For anti-SLC35B2 (ARP66680_P050-FITC) antibody is Catalog # AAP66680
Datasheets/Manuals:
Printable datasheet for anti-SLC35B2 (ARP66680_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...