SEH1L Antibody - N-terminal region : FITC (ARP75811_P050-FITC)

Catalog No: ARP75811_P050-FITC

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEH1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: FDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHMGL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-SEH1L (ARP75811_P050-FITC) antibody is Catalog # AAP75811
• Reference: N/A

Target Info

• Gene Symbol: SEH1L
• Gene Full Name: SEH1 like nucleoporin
• Alias Symbols: Seh1, SEH1A, SEH1B, SEC13L
• NCBI Gene Id: 81929
• Protein Name: nucleoporin SEH1
• Description of Target: The protein encoded by this gene is part of a nuclear pore complex, Nup107-160. This protein contains WD repeats and shares 34% amino acid identity with yeast Seh1 and 30% identity with yeast Sec13. All constituents of the Nup107-160 complex, including this protein, specifically localize to kinetochores in mitosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Uniprot ID: Q96EE3
• Protein Accession #: NP_112493
• Protein Size (# AA): 360
• Molecular Weight: 39kDa
• Protein Interactions: SUMO2; SUMO1; RPA3; RPA2; RPA1; NUP43; DCTN4; NUP160; DCTN2; NUP37; ACTR1B; HECW2; env; UBC; ATP6V0A1; NUP107; COPS5; ELAVL1; Nup98; SAP25; BECN1; USP32P2; RAE1; NUP85; NUP133;