SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP74193_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP74193_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-RRAGA (ARP74193_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human RRAGA
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: CKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTS
Concentration0.5 mg/ml
Blocking PeptideFor anti-RRAGA (ARP74193_P050-FITC) antibody is Catalog # AAP74193
Gene SymbolRRAGA
Alias SymbolsFIP1, RAGA, FIP-1
NCBI Gene Id10670
Description of TargetRRAGA is a guanine nucleotide-binding protein forming heterodimeric Rag complexes required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. Involved in the RCC1/Ran-GTPase pathway. It may play a direct role in a TNF-alpha signaling pathway leading to induction of cell death. Also it may alternatively act as a cellular target for adenovirus E3-14.7K, an inhibitor of TNF-alpha functions, thereby affecting cell death.
Uniprot IDQ7L523
Protein Accession #NP_006561
Protein Size (# AA)313
Molecular Weight34kDa
Protein InteractionsRRAGC; RPTOR; STAU1; UBC; IL7R; ASAP1; CPSF2; CPSF3; CPSF1; CSTF2T; PAPOLA; CPSF4; CSTF3; CDC73; LAMTOR1; NOL8; RRAGA; RRAGD;
  1. What is the species homology for "RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)"?

    This target may also be called "FIP1, RAGA, FIP-1" in publications.

  5. What is the shipping cost for "RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RRAGA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RRAGA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RRAGA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RRAGA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RRAGA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RRAGA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RRAGA Antibody - C-terminal region : FITC (ARP74193_P050-FITC)
Your Rating
We found other products you might like!