RPL5 Antibody - N-terminal region (ARP89609_P050)

Catalog No: ARP89609_P050

Host: Rabbit
Target Name: RPL5
Sample Tissue: Mouse Pancreas lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse RPL5
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: AYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPL5 (ARP89609_P050) antibody is Catalog # AAP89609

Target Info

• Gene Symbol: RPL5
• Gene Full Name: ribosomal protein L5
• Alias Symbols: U21, U21RNA
• NCBI Gene Id: 100503670
• Protein Name: 60S ribosomal protein L5
• Description of Target: Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel. As part of the 5S RNP/5S ribonucleoprotein particle it is an essential component of the LSU, required for its formation and the maturation of rRNAs. It also couples ribosome biogenesis to p53/TP53 activation. As part of the 5S RNP it accumulates in the nucleoplasm and inhibits MDM2, when ribosome biogenesis is perturbed, mediating the stabilization and the activation of TP53. Interacts with RRP1B.
• Uniprot ID: P47962
• Protein Accession #: NP_058676.1
• Nucleotide Accession #: NM_016980.2
• Protein Size (# AA): 297
• Molecular Weight: 34 kDa