RPL3 Antibody - C-terminal region (ARP48157_P050)

Catalog No: ARP48157_P050

WB Suggested Anti-RPL3 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateRPL3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RPL3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPL3 (ARP48157_P050) antibody is Catalog # AAP48157 (Previous Catalog # AAPY02581)
• Sample Type Confirmation:

  RPL3 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Reference: Tu,L.C., (2007) Mol. Cell Proteomics 6 (4), 575-588

Target Info

• Gene Symbol: RPL3
• Gene Full Name: Ribosomal protein L3
• Alias Symbols: L3, ASC-1, TARBP-B
• NCBI Gene Id: 6122
• Protein Name: cDNA FLJ35376 fis, clone SKMUS2004044, highly similar to Homo sapiens ribosomal protein L3 (RPL3), transcript variant 2, mRNA EMBL BAG52598.1
• Description of Target: Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. This gene is co-transcribed with several small nucleolar RNA genes, which are located in several of this gene's introns. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
• Uniprot ID: B3KS36
• Protein Accession #: NP_001029025
• Nucleotide Accession #: NM_001033853
• Protein Size (# AA): 354
• Molecular Weight: 40kDa
• Protein Interactions: UBC; HUWE1; TUBG1; TP53; SUMO2; SUMO3; NEDD1; TUBGCP4; CEP250; STAU1; ZBTB1; EED; RNF2; rev; RPL15; DARS; TBC1D4; TARDBP; PAN2; STXBP3; ILF3; FN1; SIK1; METTL18; SF3B1; NUMB; TP63; UBL4A; VCAM1; EIF4A3; MAGOH; ESR1; RPS2; RPLP0P6; RPL10L; HSP90AB1; HSP90A