- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-RPL3 (ARP48157_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human RPL3 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: YHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHY |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-RPL3 (ARP48157_P050) antibody is Catalog # AAP48157 (Previous Catalog # AAPY02581) |
Sample Type Confirmation | RPL3 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
Reference | Tu,L.C., (2007) Mol. Cell Proteomics 6 (4), 575-588 |
---|---|
Gene Symbol | RPL3 |
Gene Full Name | Ribosomal protein L3 |
Alias Symbols | L3, ASC-1, TARBP-B |
NCBI Gene Id | 6122 |
Protein Name | cDNA FLJ35376 fis, clone SKMUS2004044, highly similar to Homo sapiens ribosomal protein L3 (RPL3), transcript variant 2, mRNA EMBL BAG52598.1 |
Description of Target | Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL3 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation.Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. This gene is co-transcribed with several small nucleolar RNA genes, which are located in several of this gene's introns. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Uniprot ID | B3KS36 |
Protein Accession # | NP_001029025 |
Nucleotide Accession # | NM_001033853 |
Protein Size (# AA) | 354 |
Molecular Weight | 40kDa |
Protein Interactions | UBC; HUWE1; TUBG1; TP53; SUMO2; SUMO3; NEDD1; TUBGCP4; CEP250; STAU1; ZBTB1; EED; RNF2; rev; RPL15; DARS; TBC1D4; TARDBP; PAN2; STXBP3; ILF3; FN1; SIK1; METTL18; SF3B1; NUMB; TP63; UBL4A; VCAM1; EIF4A3; MAGOH; ESR1; RPS2; RPLP0P6; RPL10L; HSP90AB1; HSP90A |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "RPL3 Antibody - C-terminal region (ARP48157_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "RPL3 Antibody - C-terminal region (ARP48157_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "RPL3 Antibody - C-terminal region (ARP48157_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "RPL3 Antibody - C-terminal region (ARP48157_P050)"?
This target may also be called "L3, ASC-1, TARBP-B" in publications.
-
What is the shipping cost for "RPL3 Antibody - C-terminal region (ARP48157_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "RPL3 Antibody - C-terminal region (ARP48157_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "RPL3 Antibody - C-terminal region (ARP48157_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "40kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "RPL3 Antibody - C-terminal region (ARP48157_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "RPL3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "RPL3"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "RPL3"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "RPL3"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "RPL3"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "RPL3"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.