RPL13A Antibody - middle region : HRP (ARP58522_P050-HRP)

Catalog No: ARP58522_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPL13A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 91%
• Peptide Sequence: Synthetic peptide located within the following region: HEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNVEKKIDKY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RPL13A (ARP58522_P050-HRP) antibody is Catalog # AAP58522 (Previous Catalog # AAPP34536)
• Sample Type Confirmation:

  RPL13A is strongly supported by BioGPS gene expression data to be expressed in COLO205

• Reference: Hasegawa,K., (2008) Biochem. Biophys. Res. Commun. 372 (1), 51-56

Target Info

• Gene Symbol: RPL13A
• Gene Full Name: Ribosomal protein L13a
• Alias Symbols: L13A, TSTA1
• NCBI Gene Id: 23521
• Protein Name: 60S ribosomal protein L13a
• Description of Target: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal pro
• Uniprot ID: P40429
• Protein Accession #: NP_036555
• Nucleotide Accession #: NM_001752
• Protein Size (# AA): 203
• Molecular Weight: 22kDa
• Protein Interactions: HUWE1; UBC; CEP250; TUBG1; ZBTB1; RPA3; RPA2; RPA1; EED; RNF2; Erbb3; TARDBP; ETS1; IGSF8; ICAM1; PAN2; ALG12; TP63; UBL4A; VTN; VCAM1; RPL30; ND1; ITGA4; FNTA; FN1; STOM; CYP2E1; CRP; ALDH2; EIF4A3; MAGOH; ESR1; CAND1; CUL1; CUL3; CUL5; NFX1; CALM1; NOP5