Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP85157_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

RIT1 Antibody - middle region (ARP85157_P050)

Catalog#: ARP85157_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RIT1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: GSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-RIT1 (ARP85157_P050) antibody is Catalog # AAP85157
Datasheets/ManualsPrintable datasheet for anti-RIT1 (ARP85157_P050) antibody
Gene SymbolRIT1
Official Gene Full NameRas-like without CAAX 1
Alias SymbolsNS8, RIT, RIBB, ROC1
NCBI Gene Id6016
Protein NameGTP-binding protein Rit1
Description of TargetThis gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants.
Swissprot IdQ92963
Protein Accession #NP_001243749.1
Nucleotide Accession #NM_001256820.1
Protein Size (# AA)219
Molecular Weight24 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express RIT1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express RIT1.
Write Your Own Review
You're reviewing:RIT1 Antibody - middle region (ARP85157_P050)
Your Rating
Aviva ChIP Antibodies
Aviva Pathways
Aviva HIS tag Deal
Assay Development