Search Antibody, Protein, and ELISA Kit Solutions

RIT1 Antibody - middle region (ARP85157_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
RIT1
Official Gene Full Name:
Ras-like without CAAX 1
NCBI Gene Id:
6016
Protein Name:
GTP-binding protein Rit1
Swissprot Id:
Q92963
Protein Accession #:
NP_001243749.1
Nucleotide Accession #:
NM_001256820.1
Alias Symbols:
NS8, RIT, RIBB, ROC1
Description of Target:
This gene encodes a member of a subfamily of Ras-related GTPases. The encoded protein is involved in regulating p38 MAPK-dependent signaling cascades related to cellular stress. This protein also cooperates with nerve growth factor to promote neuronal development and regeneration. Alternate splicing results in multiple transcript variants.
Protein Size (# AA):
219
Molecular Weight:
24 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express RIT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express RIT1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human RIT1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: GSCCSSPAGLSREYKLVMLGAGGVGKSAMTMQFISHRFPEDHDPTIEDAY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-RIT1 (ARP85157_P050) antibody is Catalog # AAP85157
Datasheets/Manuals:
Printable datasheet for anti-RIT1 (ARP85157_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...