Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP48281_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP48281_P050-FITC Conjugated

ARP48281_P050-HRP Conjugated

ARP48281_P050-Biotin Conjugated

PRDX2 Antibody - middle region (ARP48281_P050)

Rating:
80% of 100
Catalog#: ARP48281_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-117298 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRDX2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 100%; Yeast: 92%; Zebrafish: 79%
Complete computational species homology data Anti-PRDX2 (ARP48281_P050)
Peptide Sequence Synthetic peptide located within the following region: VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-PRDX2 (ARP48281_P050) antibody is Catalog # AAP48281 (Previous Catalog # AAPY01650)
Datasheets/Manuals Printable datasheet for anti-PRDX2 (ARP48281_P050) antibody
Sample Type Confirmation

PRDX2 is supported by BioGPS gene expression data to be expressed in HeLa

Target Reference Fang,J., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (47), 18742-18747
Gene Symbol PRDX2
Official Gene Full Name Peroxiredoxin 2
Alias Symbols MGC4104, NKEFB, PRP, PRX2, PRXII, TDPX1, TSA, TPX1
NCBI Gene Id 7001
Protein Name Peroxiredoxin-2
Description of Target PRDX2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms.This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot Id P35704
Protein Accession # NP_005800
Nucleotide Accession # NM_005809
Protein Size (# AA) 198
Molecular Weight 22kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PRDX2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PRDX2.
Protein Interactions UBC; NEDD8; IPO11; CACYBP; PPP2R5D; PRDX1; METTL1; HECW2; ESR1; RAD52; NLGN3; CD320; COPS5; PRDX4; YWHAZ; VCAM1; UTY; SAT1; ITGA4; FN1; CA4; BAD; TPM3P4; TIPRL; TMEM9; RNF32; URM1; RIF1; EXOC6; CYCS; ECSIT; PRDX5; IFIT5; MAST1; PARK7; SEC23IP; CDC37; PRDX
  1. What is the species homology for "PRDX2 Antibody - middle region (ARP48281_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish".

  2. How long will it take to receive "PRDX2 Antibody - middle region (ARP48281_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PRDX2 Antibody - middle region (ARP48281_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PRDX2 Antibody - middle region (ARP48281_P050)"?

    This target may also be called "MGC4104, NKEFB, PRP, PRX2, PRXII, TDPX1, TSA, TPX1" in publications.

  5. What is the shipping cost for "PRDX2 Antibody - middle region (ARP48281_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PRDX2 Antibody - middle region (ARP48281_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PRDX2 Antibody - middle region (ARP48281_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PRDX2 Antibody - middle region (ARP48281_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "PRDX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PRDX2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PRDX2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PRDX2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PRDX2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PRDX2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PRDX2 Antibody - middle region (ARP48281_P050)
Your Rating
We found other products you might like!