Now Offering Over 102,157 Antibodies & 44,722 Antigens!

PRDX2 antibody - middle region (ARP48281_P050)

100 ul
$289.00
In Stock

Conjugation Options

ARP48281_P050-FITC Conjugated

ARP48281_P050-HRP Conjugated

ARP48281_P050-Biotin Conjugated

Gene Symbol:
PRDX2
NCBI Gene Id:
7001
Official Gene Full Name:
Peroxiredoxin 2
Protein Name:
Peroxiredoxin-2
Swissprot Id:
P35704
Protein Accession #:
NP_005800
Nucleotide Accession #:
NM_005809
Alias Symbols:
MGC4104, NKEFB, PRP, PRX2, PRXII, TDPX1, TSA, TPX1
Replacement Item:
This antibody may replace item sc-117298 from Santa Cruz Biotechnology.
Description of Target:
PRDX2 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. It may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms.This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
198
Molecular Weight:
22kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRDX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRDX2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human PRDX2
Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 100%; Yeast: 92%; Zebrafish: 79%
Complete computational species homology data:
Anti-PRDX2 (ARP48281_P050)
Peptide Sequence:
Synthetic peptide located within the following region: VLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; NEDD8; IPO11; CACYBP; PPP2R5D; PRDX1; METTL1; HECW2; ESR1; RAD52; NLGN3; CD320; COPS5; PRDX4; YWHAZ; VCAM1; UTY; SAT1; ITGA4; FN1; CA4; BAD; TPM3P4; TIPRL; TMEM9; RNF32; URM1; RIF1; EXOC6; CYCS; ECSIT; PRDX5; IFIT5; MAST1; PARK7; SEC23IP; CDC37; PRDX
Blocking Peptide:
For anti-PRDX2 (ARP48281_P050) antibody is Catalog # AAP48281 (Previous Catalog # AAPY01650)
Datasheets/Manuals:
Printable datasheet for anti-PRDX2 (ARP48281_P050) antibody
Sample Type Confirmation:

PRDX2 is supported by BioGPS gene expression data to be expressed in HeLa

Additional Information:
IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
Target Reference:
Fang,J., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (47), 18742-18747
Average Rating:
1 review
5 star
0
4 star
1
3 star
0
2 star
0
1 star
0
  • Date - Newest First
  • Date - Newest First
  • Date - Latest First
  • Highest Rated
  • Lowest Rated
  • Most Helpful
  • Ownership

1 Item(s)

81/03/2018 22:10
  • Overall Experience:
  • Quality:
Canine Brain in IHC

Submitted by:

Pratistha Tamrakar, PhD
University of Maryland Baltimore

1.       Target:

PRDX2

2.       Species and tissue/cell:

Canine Brain

3.       Fixation method:

4% PFA

4.       What antigen retrieval method was used:

Sodium Citrate 

5.       Primary antibody dilution:

1:10,000

6.       Secondary antibody and dilution:

Biotinylated - 1:600

7.       Description of stains and counterstain:

Ni DAB chromogen

 

0
0
Reply
Show more comments (-2) Hide comments

1 Item(s)

What kind of abuse are you reporting?
    Please, wait...