RBPMS2 Antibody - middle region (ARP41200_P050)

Catalog No: ARP41200_P050

WB Suggested Anti-RBPMS2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBPMS2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RBPMS2 (ARP41200_P050) antibody is Catalog # AAP41200 (Previous Catalog # AAPP22575)

Target Info

• Gene Symbol: RBPMS2
• Gene Full Name: RNA binding protein with multiple splicing 2
• Alias Symbols: -
• NCBI Gene Id: 348093
• Protein Name: RNA-binding protein with multiple splicing 2
• Description of Target: The exact function of RBPMS2 remains unknown.
• Uniprot ID: Q6ZRY4
• Protein Accession #: NP_919248
• Nucleotide Accession #: NM_194272
• Protein Size (# AA): 209
• Molecular Weight: 22kDa
• Protein Interactions: VHL; UBC;