Catalog No: P100682_P050-Biotin
Size:100ul
Price: $434.00
SKU
P100682_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-RBL1 (P100682_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RBL1
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 85%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: FLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIG
Concentration0.5 mg/ml
Blocking PeptideFor anti-RBL1 (P100682_P050-Biotin) antibody is Catalog # AAP31024 (Previous Catalog # AAPP01757)
ReferenceRoss,A.S., (2008) Biochem. Biophys. Res. Commun. 366 (4), 927-931
Gene SymbolRBL1
Gene Full NameRetinoblastoma-like 1 (p107)
Alias SymbolsPRB1, p107, CP107
NCBI Gene Id5933
Protein NameRetinoblastoma-like protein 1
Description of TargetRBL1 is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene.
Uniprot IDP28749-2
Protein Accession #NP_899662
Nucleotide Accession #NM_183404
Protein Size (# AA)1014
Molecular Weight115kDa
Protein InteractionsDYRK1B; DYRK1A; CDK2; MAGEA11; E2F1; AR; UBC; RBBP8; E2F4; PLSCR1; NUCB1; LAMB2; NR4A1; GOLGA2; FN1; EPHA2; CDK6; CDK4; AOX1; SP1; SNRPD3; DGKZ; ID2; RINT1; E2F3; E2F2; PPP1CA; TOP1; SMARCA4; CCNA2; LIN9; LIN54; LIN37; MYBL2; MAPK6; IRF3; RBL2; DHX30; NR2
  1. What is the species homology for "RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)"?

    This target may also be called "PRB1, p107, CP107" in publications.

  5. What is the shipping cost for "RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "115kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "RBL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "RBL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "RBL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "RBL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "RBL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "RBL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:RBL1 Antibody - N-terminal region : Biotin (P100682_P050-Biotin)
Your Rating