RALGPS1 Antibody - middle region (ARP42415_P050)

Catalog No: ARP42415_P050

WB Suggested Anti-RALGPS1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RALGPS1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 76%
• Peptide Sequence: Synthetic peptide located within the following region: AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-RALGPS1 (ARP42415_P050) antibody is Catalog # AAP42415 (Previous Catalog # AAPP24761)
• Reference: de (2000) J. Biol. Chem. 275 (38), 29761-29766

Target Info

• Gene Symbol: RALGPS1
• Gene Full Name: Ral GEF with PH domain and SH3 binding motif 1
• Alias Symbols: RALGEF2, RALGPS1A
• NCBI Gene Id: 9649
• Protein Name: Ras-specific guanine nucleotide-releasing factor RalGPS1
• Description of Target: RALGPS1 contains 1 PH domain and 1 Ras-GEF domain. RALGPS1 may be involved in cytoskeletal organization. It may also be involved in the stimulation of transcription in a Ras-independent fashion Guanine nucleotide exchange factor for the small GTPase RALA.
• Uniprot ID: Q5JS13
• Protein Accession #: NP_055451
• Nucleotide Accession #: NM_014636
• Protein Size (# AA): 557
• Molecular Weight: 62kDa
• Protein Interactions: Dlg4; C2orf88; APP; RALA; GRB2; NCK1;