PSMA1 Antibody - middle region (ARP90931_P050)

Catalog No: ARP90931_P050

Host: Rabbit
Target Name: PSMA1
Sample Tissue: Mouse Heart lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse PSMA1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: TADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PSMA1 (ARP90931_P050) antibody is Catalog # AAP90931

Target Info

• Gene Symbol: PSMA1
• Gene Full Name: proteasome (prosome, macropain) subunit, alpha type 1
• Alias Symbols: C2, HC2, Pro, Pros-30, alpha-type
• NCBI Gene Id: 26440
• Protein Name: proteasome subunit alpha type-1
• Description of Target: Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).
• Uniprot ID: Q9R1P4
• Protein Accession #: NP_036095.1
• Nucleotide Accession #: NM_011965.2
• Protein Size (# AA): 263
• Molecular Weight: 30 kDa