Search Antibody, Protein, and ELISA Kit Solutions

PRKACB Antibody - C-terminal region (ARP90513_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
PRKACB
Official Gene Full Name:
protein kinase, cAMP dependent, catalytic, beta
NCBI Gene Id:
18749
Protein Name:
cAMP-dependent protein kinase catalytic subunit beta
Swissprot Id:
P68181
Protein Accession #:
NP_001157670.1
Nucleotide Accession #:
NM_001164198.1
Alias Symbols:
CbPKA, Pkacb
Description of Target:
Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates GPKOW which regulates its ability to bind RNA (By similarity).
Protein Size (# AA):
351
Molecular Weight:
41 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PRKACB.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PRKACB.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse PRKACB
Predicted Species Reactivity:
Mouse
Peptide Sequence:
Synthetic peptide located within the following region: HKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-PRKACB (ARP90513_P050) antibody is Catalog # AAP90513
Datasheets/Manuals:
Printable datasheet for anti-PRKACB (ARP90513_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...