PRKACB Antibody - C-terminal region (ARP90513_P050)

Catalog No: ARP90513_P050

Host: Rabbit
Target Name: PRKACB
Sample Tissue: Mouse NIH3T3 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse PRKACB
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: HKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PRKACB (ARP90513_P050) antibody is Catalog # AAP90513

Target Info

• Gene Symbol: PRKACB
• Gene Full Name: protein kinase, cAMP dependent, catalytic, beta
• Alias Symbols: Pka, CbPKA, Pkacb
• NCBI Gene Id: 18749
• Protein Name: cAMP-dependent protein kinase catalytic subunit beta
• Description of Target: Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates GPKOW which regulates its ability to bind RNA (By similarity).
• Uniprot ID: P68181
• Protein Accession #: NP_001157670.1
• Nucleotide Accession #: NM_001164198.1
• Protein Size (# AA): 351
• Molecular Weight: 41 kDa