Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP90513_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

PRKACB Antibody - C-terminal region (ARP90513_P050)

Catalog#: ARP90513_P050
Domestic: within 24 hours delivery | International: 3-8 business days
More Information
Predicted Species ReactivityMouse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of mouse PRKACB
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: HKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEEIRVSITEKC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-PRKACB (ARP90513_P050) antibody is Catalog # AAP90513
Datasheets/ManualsPrintable datasheet for anti-PRKACB (ARP90513_P050) antibody
Gene SymbolPRKACB
Official Gene Full Nameprotein kinase, cAMP dependent, catalytic, beta
Alias SymbolsCbPKA, Pkacb
NCBI Gene Id18749
Protein NamecAMP-dependent protein kinase catalytic subunit beta
Description of TargetMediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates GPKOW which regulates its ability to bind RNA (By similarity).
Swissprot IdP68181
Protein Accession #NP_001157670.1
Nucleotide Accession #NM_001164198.1
Protein Size (# AA)351
Molecular Weight41 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express PRKACB.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express PRKACB.
Write Your Own Review
You're reviewing:PRKACB Antibody - C-terminal region (ARP90513_P050)
Your Rating
Free Microscope
Aviva Pathways
Aviva Blast Tool
Aviva ChIP Antibodies