Catalog No: ARP57781_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PPP2R1B Antibody - N-terminal region (ARP57781_P050)

Datasheets/ManualsPrintable datasheet for anti-PPP2R1B (ARP57781_P050) antibody
Product Info
ReferenceChou,H.C., (2007) Cancer Lett. 253 (1), 138-143
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R1B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-PPP2R1B (ARP57781_P050) antibody is Catalog # AAP57781 (Previous Catalog # AAPP38838)
SubunitA beta isoform
Gene SymbolPPP2R1B
Gene Full NameProtein phosphatase 2, regulatory subunit A, beta
Alias SymbolsPR65B, PP2A-Abeta
NCBI Gene Id5519
Protein NamecDNA FLJ76434, highly similar to Homo sapiens protein phosphatase 2 (formerly 2A), regulatory subunit A (PR 65), beta isoform (PPP2R1B), transcript variant 2, mRNA EMBL BAF84964.1
Description of TargetThis gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric co
Uniprot IDA8K8B0
Protein Accession #NP_859050
Nucleotide Accession #NM_181699
Protein Size (# AA)667
Molecular Weight73kDa
  1. What is the species homology for "PPP2R1B Antibody - N-terminal region (ARP57781_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "PPP2R1B Antibody - N-terminal region (ARP57781_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PPP2R1B Antibody - N-terminal region (ARP57781_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "PPP2R1B Antibody - N-terminal region (ARP57781_P050)"?

    This target may also be called "PR65B, PP2A-Abeta" in publications.

  5. What is the shipping cost for "PPP2R1B Antibody - N-terminal region (ARP57781_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PPP2R1B Antibody - N-terminal region (ARP57781_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PPP2R1B Antibody - N-terminal region (ARP57781_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "73kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PPP2R1B Antibody - N-terminal region (ARP57781_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PPP2R1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PPP2R1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PPP2R1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PPP2R1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PPP2R1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PPP2R1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PPP2R1B Antibody - N-terminal region (ARP57781_P050)
Your Rating
We found other products you might like!