Search Antibody, Protein, and ELISA Kit Solutions

PPME1 Antibody - N-terminal region (ARP56845_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56845_P050-FITC Conjugated

ARP56845_P050-HRP Conjugated

ARP56845_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Protein phosphatase methylesterase 1
NCBI Gene Id:
Protein Name:
Protein phosphatase methylesterase 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FLJ22226, PME-1
Replacement Item:
This antibody may replace item sc-127356 from Santa Cruz Biotechnology.
Description of Target:
Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit.Protein phosphatase methylesterase-1 catalyzes the demethylation of the protein phosphatase-2A catalytic subunit (PPP2CA; MIM 176915) (Ogris et al., 1999 [PubMed 10318862]).[supplied by OMIM].
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express PPME1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express PPME1.
The immunogen is a synthetic peptide directed towards the N terminal region of human PPME1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 81%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-PPME1 (ARP56845_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PGRKRDFSPVPWSQYFESMEDVEVENETGKDTFRVYKSGSEGPVLLLLHG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-PPME1 (ARP56845_P050) antibody is Catalog # AAP56845 (Previous Catalog # AAPP35430)
Printable datasheet for anti-PPME1 (ARP56845_P050) antibody
Sample Type Confirmation:

PPME1 is supported by BioGPS gene expression data to be expressed in 721_B

Target Reference:
Longin,S., (2008) Exp. Cell Res. 314 (1), 68-81

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...