PPIL3 Antibody - middle region (ARP51172_P050)

Catalog No: ARP51172_P050

WB Suggested Anti-PPIL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: COLO205 cell lysatePPIL3 is supported by BioGPS gene expression data to be expressed in COLO205

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPIL3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 93%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: NYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVR
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP51172 (Previous Catalog # AAPP28043)
• Sample Type Confirmation:

  PPIL3 is supported by BioGPS gene expression data to be expressed in COLO205

Target Info

• Gene Symbol: PPIL3
• Gene Full Name: Peptidylprolyl isomerase (cyclophilin)-like 3
• Alias Symbols: CYPJ
• NCBI Gene Id: 53938
• Protein Name: Peptidyl-prolyl cis-trans isomerase-like 3
• Description of Target: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants.
• Uniprot ID: Q9H2H8
• Protein Accession #: NP_570981
• Nucleotide Accession #: NM_130906
• Protein Size (# AA): 161
• Molecular Weight: 18
• Protein Interactions: SLU7; BAG3; UBC; PCBP1; NUDCD2; GINS4; TMOD3; RPAP1; SEPHS1; SUGT1; AHCYL1; SEC24C; SUMO1; RCN1; RAD23B; PSMA1; IGBP1; UBD; ELAVL1;