PNC1 Recombinant Protein (Saccharomyces cerevisiae) (OPCA05254)

Catalog No: OPCA05254

Product Info

• Predicted Species Reactivity: Saccharomyces cerevisiae
• Product Format: Liquid
• Additional Information: Species Specificity Detail: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
• Reconstitution and Storage: Briefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Full Length: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK
• Storage Buffer: Tris-base, 50% glycerol
• Source: E.coli
• Tag: NO-tagged
• Reference: Identification and functional analysis of the Saccharomyces cerevisiae nicotinamidase gene, PNC1.
  Ghislain M., Talla E., Francois J.M.
  Yeast 19:215-224(2002)

Target Info

• Gene Symbol: PNC1
• Protein Name: Nicotinamidase
• Description of Target: Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regulates SIR2-mediated silencing and longevity by preventing the accumulation of intracellular nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate.
• Uniprot ID: P53184
• Molecular Weight: 25 kDa