PEPD Antibody - middle region (ARP74721_P050)

Catalog No: ARP74721_P050

Host: Rabbit
Target Name: PEPD
Sample Tissue: 786-0 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEPD
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: CICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-PEPD (ARP74721_P050) antibody is Catalog # AAP74721

Target Info

• Gene Symbol: PEPD
• Gene Full Name: peptidase D
• Alias Symbols: PROLIDASE
• NCBI Gene Id: 5184
• Protein Name: xaa-Pro dipeptidase
• Description of Target: This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P12955
• Protein Accession #: NP_000276.2
• Nucleotide Accession #: NM_000285.3
• Protein Size (# AA): 493
• Molecular Weight: 54 kDa