SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP58649_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP58649_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-PCSK4 (ARP58649_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PCSK4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT
Concentration0.5 mg/ml
Blocking PeptideFor anti-PCSK4 (ARP58649_P050-FITC) antibody is Catalog # AAP58649 (Previous Catalog # AAPP35786)
ReferenceQiu,Q., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (31), 11047-11052
Gene SymbolPCSK4
Gene Full NameProprotein convertase subtilisin/kexin type 4
Alias SymbolsPC4, SPC5
NCBI Gene Id54760
Protein NameProprotein convertase subtilisin/kexin type 4
Description of TargetPCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin. These enzymes process precursor proteins to their active forms by selective cleavage of the polypeptide at sites following paired basic amino acids. In mammals, this family comprises PC1 (MIM 162150), PC2 (MIM 162151), PC4, PC5 (MIM 600488), furin (FUR; MIM 136950), and PACE4 (MIM 167405). Substrates for these enzymes range from prohormones to precursors for growth factors to cell surface receptors and viral surface glycoproteins (Cao et al., 2001 [PubMed 11776387]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-31 AC027307.5 80201-80231 c 32-257 AY358963.1 32-257 258-655 AK057235.1 452-849 656-2528 AY358963.1 656-2528 2529-2606 AL043305.1 210-287 2607-2674 AA453604.1 1-68 c
Uniprot IDQ6UW60
Protein Accession #NP_060043
Nucleotide Accession #NM_017573
Protein Size (# AA)755
Molecular Weight83kDa
Protein InteractionsIGF2;
  1. What is the species homology for "PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig".

  2. How long will it take to receive "PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)"?

    This target may also be called "PC4, SPC5" in publications.

  5. What is the shipping cost for "PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "83kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PCSK4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PCSK4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PCSK4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PCSK4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PCSK4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PCSK4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PCSK4 Antibody - N-terminal region : FITC (ARP58649_P050-FITC)
Your Rating
We found other products you might like!