Loading...
Catalog No: ARP57919_P050
Price: $0.00
SKU
ARP57919_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

PCAF Antibody - C-terminal region (ARP57919_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-KAT2B (ARP57919_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PCAF
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: PGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSI
Concentration0.5 mg/ml
Blocking PeptideFor anti-KAT2B (ARP57919_P050) antibody is Catalog # AAP57919 (Previous Catalog # AAPP32330)
ReferenceZeng,L., (2008) Structure 16 (4), 643-652
Gene SymbolKAT2B
Gene Full NameK(lysine) acetyltransferase 2B
Alias SymbolsCAF, PCAF, P/CAF
NCBI Gene Id8850
Protein NameHistone acetyltransferase KAT2B
Description of TargetCBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. PCAF associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-749 AC099057.3 17115-17863 750-876 AC099057.3 49416-49542 877-1022 AC099057.3 72346-72491 1023-1115 AC099057.3 76945-77037 1116-1297 AC099057.3 78370-78551 1298-1489 AC099057.3 88679-88870 1490-1596 AC099057.3 91965-92071 1597-1722 AC099057.3 96681-96806 1723-1859 AC099057.3 99751-99887 1860-2068 AC099057.3 102988-103196 2069-2195 AC099057.3 104506-104632 2196-2306 AC099057.3 114025-114135 2307-2450 AC099057.3 117304-117447 2451-2565 AC099057.3 123399-123513 2566-2602 AC099057.3 125046-125082 2603-2666 AC099057.3 125326-125389 2667-2751 AC099057.3 125486-125570 2752-4824 AC099057.3 129415-131487
Uniprot IDQ92831
Protein Accession #NP_003875
Nucleotide Accession #NM_003884
Protein Size (# AA)832
Molecular Weight93kDa
Protein InteractionsMDM2; HNRNPD; ACLY; KLF2; E2F1; VHL; IRF1; TAL1; TAF12; TAF10; TAF9; TADA2A; RB1; HIST1H1B; TAF5L; TAF6L; TADA3; SUPT3H; TWIST1; PDK1; AKT1; UBC; SIAH2; UBE2D3; UBE2D1; TP73; TP53; SRC; PGR; YEATS2; MBIP; WDR5; PTEN; DR1; HIF1A; HIST2H3C; CHEK2; HIST1H4A;
  1. What is the species homology for "PCAF Antibody - C-terminal region (ARP57919_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "PCAF Antibody - C-terminal region (ARP57919_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PCAF Antibody - C-terminal region (ARP57919_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PCAF Antibody - C-terminal region (ARP57919_P050)"?

    This target may also be called "CAF, PCAF, P/CAF" in publications.

  5. What is the shipping cost for "PCAF Antibody - C-terminal region (ARP57919_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "PCAF Antibody - C-terminal region (ARP57919_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PCAF Antibody - C-terminal region (ARP57919_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "93kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PCAF Antibody - C-terminal region (ARP57919_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "KAT2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "KAT2B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "KAT2B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "KAT2B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "KAT2B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "KAT2B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:PCAF Antibody - C-terminal region (ARP57919_P050)
Your Rating
We found other products you might like!