Search Antibody, Protein, and ELISA Kit Solutions

OR1A1 Antibody - middle region (ARP96861_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
OR1A1
Official Gene Full Name:
olfactory receptor family 1 subfamily A member 1
NCBI Gene Id:
8383
Protein Name:
olfactory receptor 1A1
Swissprot Id:
Q9P1Q5
Protein Accession #:
NP_055380.2
Nucleotide Accession #:
NM_014565.2
Alias Symbols:
OR17-7
Description of Target:
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Protein Size (# AA):
309
Molecular Weight:
33 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OR1A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OR1A1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human OR1A1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RSCIWLIAGSWVIGNANALPHTLLTASLSFCGNQEVANFYCDITPLLKLS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-OR1A1 (ARP96861_P050) antibody is Catalog # AAP96861
Datasheets/Manuals:
Printable datasheet for anti-OR1A1 (ARP96861_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...