Search Antibody, Protein, and ELISA Kit Solutions

OPTC Antibody - C-terminal region (ARP55034_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP55034_P050-FITC Conjugated

ARP55034_P050-HRP Conjugated

ARP55034_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human OPTC
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Dog: 100%; Guinea Pig: 85%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 83%
Complete computational species homology data:
Anti-OPTC (ARP55034_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-OPTC (ARP55034_P050) antibody is Catalog # AAP55034 (Previous Catalog # AAPP32295)
Datasheets/Manuals:
Printable datasheet for anti-OPTC (ARP55034_P050) antibody
Target Reference:
Kumar,A., (er) Mol. Vis. 13, 667-676 (2007)
Gene Symbol:
OPTC
Official Gene Full Name:
Opticin
Alias Symbols:
OPT
NCBI Gene Id:
26254
Protein Name:
Opticin
Description of Target:
Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also ocalizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases age-related macular degeneration (AMD) and posterior column ataxia with retinosa pigmentosa (AXPC1).Opticin belongs to class III of the small leucine-rich repeat protein (SLRP) family. Members of this family are typically associated with the extracellular matrix. Opticin is present in significant quantities in the vitreous of the eye and also localizes to the cornea, iris, ciliary body, optic nerve, choroid, retina, and fetal liver. Opticin may noncovalently bind collagen fibrils and regulate fibril morphology, spacing, and organization. The opticin gene is mapped to a region of chromosome 1 that is associated with the inherited eye diseases age-related macular degeneration (AMD) and posterior column ataxia with retinosa pigmentosa (AXPC1).
Swissprot Id:
Q9UBM4
Protein Accession #:
NP_055174
Nucleotide Accession #:
NM_014359
Protein Size (# AA):
332
Molecular Weight:
35kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OPTC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OPTC.
Protein Interactions:
OSGEP; OPTC;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...