Search Antibody, Protein, and ELISA Kit Solutions

OLFR8 Antibody - C-terminal region (ARP96619_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Mouse
Predicted Species Reactivity:
Mouse
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
OLFR8
Official Gene Full Name:
olfactory receptor 8
NCBI Gene Id:
18372
Protein Name:
Olfactory receptor 8
Swissprot Id:
Q60892
Protein Accession #:
NP_997084.1
Nucleotide Accession #:
NM_207201.1
Alias Symbols:
MOR139-5P, GA_x5J8B7TNKDU-1250-1574
Description of Target:
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Protein Size (# AA):
310
Molecular Weight:
35 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express OLFR8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express OLFR8.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of mouse OLFR8
Peptide Sequence:
Synthetic peptide located within the following region: VYVSSAVVQSSHSAARASVMYTVVTPMLNPFIYSLRNKDVKKALERLLEG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-OLFR8 (ARP96619_P050) antibody is Catalog # ARP96619_P050
Datasheets/Manuals:
Printable datasheet for anti-OLFR8 (ARP96619_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...