NUCLEOPHOSMIN Antibody (OABB01824)

Catalog No: OABB01824

Size:100UG

Click here to learn more about Aviva's By-Request Conjugation Service.

Anti-Nucleophosmin Picoband antibody, OABB01824, Western blotting
All lanes: Anti Nucleophosmin (OABB01824) at 0.5ug/ml
Lane 1: Rat Testis Tissue Lysate at 50ug
Lane 2: Mouse Testis Tissue Lysate at 50ug
Lane 3: SKOV Whole Cell Lysate at 40ug
Lane 4: HEPA Whole Cell Lysate at 40ug
Lane 5: JURKAT Whole Cell Lysate at 40ug
Lane 6: HUT Whole Cell Lysate at 40ug
Lane 7: HELA Whole Cell Lysate at 40ug
Predicted bind size: 33KD
Observed bind size: 38KD

Anti-Nucleophosmin Picoband antibody, OABB01824, IHC(P)
IHC(P): Human Intestinal Cancer Tissue

Anti-Nucleophosmin Picoband antibody, OABB01824, IHC(P)
IHC(P): Mouse Intestine Tissue

Anti-Nucleophosmin Picoband antibody, OABB01824, IHC(P)
IHC(P): Rat Intestine Tissue

Product Info

• Tested Species Reactivity: Human, Mouse, Rat
• Predicted Species Reactivity: Human|Mouse|Rat
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Flow cytometry|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Western blot
• Additional Information: Notes: WB: The detection limit for Nucleophosmin is approximately 0.1ng/lane under reducing conditions.
  Tested Species: In-house tested species with positive results.
  By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  
  Background: NPM1(Nucleophosmin/Nucleoplasmin family, member1), also known as NPM, nucleolar phosphoprotein B23 or numatrin, is a protein that in humans is encoded by the NPM1 gene. The NPM1 gene maps to chromosome 5q35. Chan et al. (1989) found that nucleophosmin is a nucleolar phosphoprotein that is more abundant in tumor cells than in normal resting cells. Stimulation of the growth of normal cells, e.g., mitogen activation of B lymphocytes, was accompanied by an increase in nucleophosmin protein level. They stated that nucleophosmin is likely involved in the assembly of ribosomal proteins into ribosomes. Electron microscopic study indicated that nucleophosmin is concentrated in the granular region of the nucleolus, where ribosome assembly occurs.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: E.coli-derived human Nucleophosmin recombinant protein (Position: M1-L294). Human Nucleophosmin shares 95% amino acid (aa) sequence identity with both mouse and rat Nucleophosmin.
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Human, Mouse, Rat
  Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat
• Reference: 1. Chan, W.-Y., Liu, Q.-R., Borjigin, J., Busch, H., Rennert, O. M., Tease, L. A., Chan, P.-K. Characterization of the cDNA encoding human nucleophosmin and studies of its role in normal and abnormal growth. Biochemistry 28: 1033-1039, 1989.
  2. Gale, R. E., Green, C., Allen, C., Mead, A. J., Burnett, A. K., Hills, R. K., Linch, D. C. The impact of FLT3 tandem duplication mutant level, number, size, and interaction with NPM1 mutations in a large cohort of young adult patients with acute myeloid leukemia. Blood 111: 2776-2784, 2008.
  3. Zhang, Q., Wang, H. Y., Liu, X., Wasik, M. A. STAT5A is epigenetically silenced by the tyrosine kinase NPM1-ALK and acts as a tumor suppressor by reciprocally inhibiting NPM1-ALK expression. Nature Med. 13: 1341-1348, 2007.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Nucleophosmin(NPM1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Target Info

• Gene Symbol: NPM1
• Gene Full Name: nucleophosmin 1
• Alias Symbols: B23;NPM;Nucleolar phosphoprotein B23;nucleolar protein NO38;nucleophosmin;nucleophosmin (nucleolar phosphoprotein B23, numatrin);nucleophosmin/nucleoplasmin family, member 1;Numatrin;testicular tissue protein Li 128.
• NCBI Gene Id: 4869
• Protein Name: Nucleophosmin
• Description of Target: Involved in diverse cellular processes such as ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, cell proliferation, and regulation of tumor suppressors p53/TP53 and ARF. Binds ribosome presumably to drive ribosome nuclear export. Associated with nucleolar ribonucleoprotein structures and bind single-stranded nucleic acids. Acts as a chaperonin for the core histones H3, H2B and H4. Stimulates APEX1 endonuclease activity on apurinic/apyrimidinic (AP) double-stranded DNA but inhibits APEX1 endonuclease activity on AP single-stranded RNA. May exert a control of APEX1 endonuclease activity within nucleoli devoted to repair AP on rDNA and the removal of oxidized rRNA molecules. In concert with BRCA2, regulates centrosome duplication. Regulates centriole duplication: phosphorylation by PLK2 is able to trigger centriole replication. Negatively regulates the activation of EIF2AK2/PKR and suppresses apoptosis through inhibition of EIF2AK2/PKR autophosphorylation. Antagonizes the inhibitory effect of ATF5 on cell proliferation and relieves ATF5-induced G2/M blockade (PubMed:22528486). In complex with MYC enhances the transcription of MYC target genes (PubMed:25956029).
• Uniprot ID: P06748
• Molecular Weight: 32575 MW