Search Antibody, Protein, and ELISA Kit Solutions

NR5A1 Antibody - middle region (ARP31834_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31834_P050-FITC Conjugated

ARP31834_P050-HRP Conjugated

ARP31834_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Nuclear receptor subfamily 5, group A, member 1
NCBI Gene Id:
Protein Name:
Steroidogenic factor 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-10975 from Santa Cruz Biotechnology.
Description of Target:
NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express NR5A1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express NR5A1.
The immunogen is a synthetic peptide directed towards the middle region of human NR5A1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 79%; Rabbit: 85%; Rat: 92%; Sheep: 85%
Complete computational species homology data:
Anti-NR5A1 (ARP31834_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AVPGAHGPLAGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-NR5A1 (ARP31834_P050) antibody is Catalog # AAP31834 (Previous Catalog # AAPP07402)
Printable datasheet for anti-NR5A1 (ARP31834_P050) antibody
Sample Type Confirmation:

NR5A1 is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Li,L.A., et al., (2004) J. Steroid Biochem. Mol. Biol. 91 (1-2), 11-20

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...