NARF Antibody - middle region (ARP54491_P050)

Catalog No: ARP54491_P050

WB Suggested Anti-NARF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NARF
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 85%; Dog: 100%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NARF (ARP54491_P050) antibody is Catalog # AAP54491 (Previous Catalog # AAPP44502)

Target Info

• Gene Symbol: NARF
• Gene Full Name: Nuclear prelamin A recognition factor
• Alias Symbols: IOP2
• NCBI Gene Id: 26502
• Protein Name: cDNA FLJ32404 fis, clone SKMUS2000380, highly similar to Homo sapiens nuclear prelamin A recognition factor (NARF), transcript variant 1, mRNA EMBL BAG51834.1
• Description of Target: Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.
• Uniprot ID: B3KPX2
• Protein Accession #: NP_001033707
• Nucleotide Accession #: NM_001038618
• Protein Size (# AA): 397
• Molecular Weight: 45kDa
• Protein Interactions: UBC; LEF1; STAT5A; SHFM1; MMS19; CBX5; APP; LMNA;