- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)
| Datasheets/Manuals | Printable datasheet for OAAF07659-FITC |
|---|
| Predicted Species Reactivity | Human, Mouse |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB, ELISA |
| Additional Information | Modification Sites: Human:S49 Mouse:S49 |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Myogenic Factor 5 around the phosphorylation site of Ser49. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: IPSPEGEFGDEFVPRVAAFGAHKAELQGSDEDEHVRAPTGHHQAGHCLMW |
| Concentration | 1 mg/ml |
| Specificity | Myogenic Factor 5 (Phospho-Ser49) Antibody detects endogenous levels of Myogenic Factor 5 only when phosphorylated at Ser49. |
| Application Info | WB: 1:500~1:1000 ELISA: 1:1000 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse".
-
How long will it take to receive "Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)"?
This item is available "Domestic: within 1 week delivery | International: 1 week".
-
What buffer format is "Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)"?
This target may also be called "EORVA, bHLHc2" in publications.
-
What is the shipping cost for "Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "28 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "Myogenic Factor 5 Antibody (Phospho-Ser49) : FITC (OAAF07659-FITC)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MYF5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MYF5"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MYF5"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MYF5"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MYF5"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MYF5"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
