MSL3 Antibody - C-terminal region (ARP75391_P050)

Catalog No: ARP75391_P050

Host: Rabbit
Target Name: MSL3
Sample Tissue: Human Stomach Tumor lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MSL3
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: STRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MSL3 (ARP75391_P050) antibody is Catalog # AAP75391

Target Info

• Gene Symbol: MSL3
• Gene Full Name: male-specific lethal 3 homolog (Drosophila)
• Alias Symbols: MRSXBA, MRXS36, MRXSBA, MSL3L1
• NCBI Gene Id: 10943
• Protein Name: male-specific lethal 3 homolog
• Description of Target: This gene encodes a nuclear protein that is similar to the product of the Drosophila male-specific lethal-3 gene. The Drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus, the human protein is thought to play a similar function in chromatin remodeling and transcriptional regulation, and it has been found as part of a complex that is responsible for histone H4 lysine-16 acetylation. This gene can undergo X inactivation. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 7 and 8.
• Uniprot ID: Q8N5Y2
• Protein Accession #: NP_523353
• Nucleotide Accession #: NM_001193270.2
• Protein Size (# AA): 521
• Molecular Weight: 57 kDa