SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP64618_P050
Price: $0.00
SKU
ARP64618_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MMP25 (ARP64618_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 82%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: FGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MMP25 (ARP64618_P050) antibody is Catalog # AAP64618
Gene SymbolMMP25
Gene Full NameMatrix metallopeptidase 25
Alias SymbolsMMP20, MMPL1, MMP-25, MMP20A, MT6MMP, MTMMP6, MT-MMP6, MT6-MMP, MT-MMP 6
NCBI Gene Id64386
Protein NameMatrix metalloproteinase-25
Description of TargetProteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily, attached to the plasma membrane via a glycosylphosphatidyl inositol anchor. In response to bacterial infection or inflammation, the encoded protein is thought to inactivate alpha-1 proteinase inhibitor, a major tissue protectant against proteolytic enzymes released by activated neutrophils, facilitating the transendothelial migration of neutrophils to inflammatory sites. The encoded protein may also play a role in tumor invasion and metastasis through activation of MMP2. The gene has previously been referred to as MMP20 but has been renamed MMP25.
Uniprot IDQ9NPA2
Protein Accession #NP_071913
Nucleotide Accession #NM_022468
Protein Size (# AA)562
Molecular Weight48kDa
Protein InteractionsCLU; MMP2;
  1. What is the species homology for "MMP25 Antibody - middle region (ARP64618_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "MMP25 Antibody - middle region (ARP64618_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MMP25 Antibody - middle region (ARP64618_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MMP25 Antibody - middle region (ARP64618_P050)"?

    This target may also be called "MMP20, MMPL1, MMP-25, MMP20A, MT6MMP, MTMMP6, MT-MMP6, MT6-MMP, MT-MMP 6" in publications.

  5. What is the shipping cost for "MMP25 Antibody - middle region (ARP64618_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MMP25 Antibody - middle region (ARP64618_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MMP25 Antibody - middle region (ARP64618_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "48kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MMP25 Antibody - middle region (ARP64618_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MMP25"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MMP25"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MMP25"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MMP25"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MMP25"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MMP25"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MMP25 Antibody - middle region (ARP64618_P050)
Your Rating