Size:100 ul
$249.00
In Stock
SKU
ARP37504_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP37504_T100-FITC Conjugated

ARP37504_T100-HRP Conjugated

ARP37504_T100-Biotin Conjugated

MKL1 Antibody - C-terminal region (ARP37504_T100)

Catalog#: ARP37504_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Mouse
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133795 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide corresponding to a region of Mouse
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data Anti-MKL1 (ARP37504_T100)
Peptide Sequence Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MKL1 (ARP37504_T100) antibody is Catalog # AAP37504 (Previous Catalog # AAPP09616)
Datasheets/Manuals Printable datasheet for anti-MKL1 (ARP37504_T100) antibody
Target Reference Sasazuki,T., et al., (2002) J. Biol. Chem. 277 (32), 28853-28860
Gene Symbol MKL1
Official Gene Full Name MKL (megakaryoblastic leukemia)/myocardin-like 1
Alias Symbols Mal, AMKL, Bsac, Mrtf-A, AI852829, AW743281, AW821984
NCBI Gene Id 223701
Protein Name MKL/myocardin-like protein 1
Description of Target MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
Swissprot Id Q8K4J6
Protein Accession # NP_694629
Nucleotide Accession # NM_153049
Protein Size (# AA) 964
Molecular Weight 106kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MKL1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MKL1.
Protein Interactions Lhx2; SRF;
  1. What is the species homology for "MKL1 Antibody - C-terminal region (ARP37504_T100)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MKL1 Antibody - C-terminal region (ARP37504_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MKL1 Antibody - C-terminal region (ARP37504_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MKL1 Antibody - C-terminal region (ARP37504_T100)"?

    This target may also be called "Mal, AMKL, Bsac, Mrtf-A, AI852829, AW743281, AW821984" in publications.

  5. What is the shipping cost for "MKL1 Antibody - C-terminal region (ARP37504_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MKL1 Antibody - C-terminal region (ARP37504_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MKL1 Antibody - C-terminal region (ARP37504_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "106kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MKL1 Antibody - C-terminal region (ARP37504_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MKL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MKL1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MKL1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MKL1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MKL1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MKL1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MKL1 Antibody - C-terminal region (ARP37504_T100)
Your Rating
We found other products you might like!