Search Antibody, Protein, and ELISA Kit Solutions

MKL1 Antibody - C-terminal region (ARP37504_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP37504_T100-FITC Conjugated

ARP37504_T100-HRP Conjugated

ARP37504_T100-Biotin Conjugated

Gene Symbol:
MKL1
Official Gene Full Name:
MKL (megakaryoblastic leukemia)/myocardin-like 1
NCBI Gene Id:
223701
Protein Name:
MKL/myocardin-like protein 1
Swissprot Id:
Q8K4J6
Protein Accession #:
NP_694629
Nucleotide Accession #:
NM_153049
Alias Symbols:
Mal, AMKL, Bsac, Mrtf-A, AI852829, AW743281, AW821984
Replacement Item:
This antibody may replace item sc-133795 from Santa Cruz Biotechnology.
Description of Target:
MKL1 transduces cytoskeletal signals and induces smooth muscle cell differentiation from undifferentiated embryonic stem cells
Protein Size (# AA):
964
Molecular Weight:
106kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MKL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MKL1.
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Mouse
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Horse: 86%; Human: 79%; Mouse: 100%; Pig: 86%; Rabbit: 86%; Rat: 100%; Zebrafish: 75%
Complete computational species homology data:
Anti-MKL1 (ARP37504_T100)
Peptide Sequence:
Synthetic peptide located within the following region: QPLSQPGFPAPGPPAQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Lhx2; SRF;
Blocking Peptide:
For anti-MKL1 (ARP37504_T100) antibody is Catalog # AAP37504 (Previous Catalog # AAPP09616)
Datasheets/Manuals:
Printable datasheet for anti-MKL1 (ARP37504_T100) antibody
Target Reference:
Sasazuki,T., et al., (2002) J. Biol. Chem. 277 (32), 28853-28860

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...