MED36B Recombinant Protein (Mouse-ear cress) (OPCA05066)

Catalog No: OPCA05066

Product Info

• Predicted Species Reactivity: Arabidopsis thaliana
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Arabidopsis thaliana (Mouse-ear cress)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MRPPVTGGRGGGGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGRGRGAPRGRGGPPRGGMKGGSKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASFFLKTGGHFVISIKANCIDSTVAAEAVFQSEVKKLQQEQFKPAEQVTLEPFERDHACVVGGYRMPKKQKTPAS
• Protein Sequence: MRPPVTGGRGGGGFRGGRDGGGRGFGGGRSFGGGRSGDRGRSGPRGRGRGAPRGRGGPPRGGMKGGSKVIVEPHRHAGVFIAKGKEDALVTKNLVPGEAVYNEKRISVQNEDGTKVEYRVWNPFRSKLAAAILGGVDNIWIKPGAKVLYLGAASGTTVSHVSDLVGPEGCVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGMVDVIFSDVAQPDQARILALNASFFLKTGGHFVISIKANCIDSTVAAEAVFQSEVKKLQQEQFKPAEQVTLEPFERDHACVVGGYRMPKKQKTPAS
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-308 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Fibrillarin genes encode both a conserved nucleolar protein and a novel small nucleolar RNA involved in ribosomal RNA methylation in Arabidopsis thaliana. Barneche F., Steinmetz F., Echeverria M. J. Biol. Chem. 275:27212-27220(2000)

Target Info

• Gene Symbol: FIB1
• Gene Full Name: fibrillarin 1
• Alias Symbols: AT5G52470;ATFBR1;ATFIB1;FBR1;fibrillarin 1;Histone-glutamine methyltransferase;K24M7.22;K24M7_22;rRNA 2'-O-methyltransferase fibrillarin 1;SKIP7;SKP1/ASK1-INTERACTING PROTEIN;SKP1-interacting partner 7.
• NCBI Gene Id: 835323
• Protein Name: Probable mediator of RNA polymerase II transcription subunit 36b
• Description of Target: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional pre-initiation complex with RNA polymerase II and the general transcription factors (By similarity).
• Uniprot ID: Q9FEF8
• Protein Accession #: NP_001119418
• Nucleotide Accession #: NM_001125946
• Protein Size (# AA): Recombinant
• Molecular Weight: 48.8 kDa