MAJOR POLLEN ALLERGEN CAR B 1 ISOFORM 2 Recombinant Protein (European hornbeam) (OPCA04311)

Catalog No: OPCA04311

Product Info

• Predicted Species Reactivity: Carpinus betulus
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: European hornbeam
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
• Protein Sequence: GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 2-160 aa
• Tag: N-terminal 6xHis-tagged
• Reference: PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betulus, hornbeam.Nedergaard Larsen J., Stroeman P., Ipsen H.Mol. Immunol. 29:703-711(1992)

Target Info

• Alias Symbols: Allergen Car b I.
• Protein Name: Major pollen allergen Car b 1 isoform 2
• Uniprot ID: P38950
• Protein Size (# AA): Recombinant
• Molecular Weight: 19.4 kDa