Catalog No: ARP54410_P050
Price: $0.00
SKU
ARP54410_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MAGEA4 (ARP54410_P050) antibody
Product Info
ReferenceRies,J., (2008) J. Oral Pathol. Med. 37 (2), 88-93
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MAGEA4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP
Concentration0.5 mg/ml
Blocking PeptideFor anti-MAGEA4 (ARP54410_P050) antibody is Catalog # AAP54410 (Previous Catalog # AAPP31185)
Gene SymbolMAGEA4
Gene Full NameMelanoma antigen family A, 4
Alias SymbolsCT1.4, MAGE4, MAGE4A, MAGE4B, MAGE-41, MAGE-X2
NCBI Gene Id4103
Protein NameMelanoma-associated antigen 4
Description of TargetMAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene.
Uniprot IDP43358
Protein Accession #NP_001011548
Nucleotide Accession #NM_001011548
Protein Size (# AA)317
Molecular Weight35kDa
Protein InteractionsAMOTL2; WBP2; UQCRB; TK1; GTF3C1; TEKT4; TRIM69; TIGD5; BEX2; UBXN6; AMOT; ARNT2; UBC; APP; HLA-A; PIAS2; PSMD10; POT1;
  1. What is the species homology for "MAGEA4 Antibody - C-terminal region (ARP54410_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".

  2. How long will it take to receive "MAGEA4 Antibody - C-terminal region (ARP54410_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAGEA4 Antibody - C-terminal region (ARP54410_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAGEA4 Antibody - C-terminal region (ARP54410_P050)"?

    This target may also be called "CT1.4, MAGE4, MAGE4A, MAGE4B, MAGE-41, MAGE-X2" in publications.

  5. What is the shipping cost for "MAGEA4 Antibody - C-terminal region (ARP54410_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MAGEA4 Antibody - C-terminal region (ARP54410_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAGEA4 Antibody - C-terminal region (ARP54410_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAGEA4 Antibody - C-terminal region (ARP54410_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAGEA4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAGEA4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAGEA4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAGEA4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAGEA4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAGEA4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MAGEA4 Antibody - C-terminal region (ARP54410_P050)
Your Rating
We found other products you might like!