Search Antibody, Protein, and ELISA Kit Solutions

LITAF Antibody - N-terminal region : FITC (ARP74033_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74033_P050 Unconjugated

ARP74033_P050-HRP Conjugated

ARP74033_P050-Biotin Conjugated

Gene Symbol:
LITAF
NCBI Gene Id:
9516
Swissprot Id:
Q99732-2
Alias Symbols:
LITAF, PIG7, SIMPLE,
Replacement Item:
This antibody may replace item sc-110364 from Santa Cruz Biotechnology.
Description of Target:
Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppresor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.
Protein Size (# AA):
228
Molecular Weight:
25kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express LITAF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express LITAF.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LITAF
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: PSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
REEP6; UBQLN1; STAM2; CALCOCO2; BAG3; HGS; UBC; STAT6; ATXN1; ITCH; TSG101; NEDD4; ELAVL1; RADIL; SMAD2; COMT;
Blocking Peptide:
For anti-LITAF (ARP74033_P050-FITC) antibody is Catalog # AAP74033
Datasheets/Manuals:
Printable datasheet for anti-LITAF (ARP74033_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...