Catalog No: ARP54779_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

LGALS3BP Antibody - middle region (ARP54779_P050)

Datasheets/ManualsPrintable datasheet for anti-LGALS3BP (ARP54779_P050) antibody
Product Info
ReferenceLee,Y.J., Clin. Exp. Rheumatol. 25 (4 SUPPL 45), S41-S45 (2007)
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human LGALS3BP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 83%; Dog: 83%; Human: 100%; Mouse: 100%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS
Concentration0.5 mg/ml
Blocking PeptideFor anti-LGALS3BP (ARP54779_P050) antibody is Catalog # AAP54779 (Previous Catalog # AAPP31574)
Gene SymbolLGALS3BP
Gene Full Namegalectin 3 binding protein
Alias Symbols90K, M2BP, gp90, CyCAP, BTBD17B, MAC-2-BP, TANGO10B
NCBI Gene Id3959
Protein Namegalectin-3-binding protein
Description of TargetThe galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.
Uniprot IDQ08380
Protein Accession #NP_005558
Nucleotide Accession #NM_005567
Protein Size (# AA)585
Molecular Weight63kDa
  1. What is the species homology for "LGALS3BP Antibody - middle region (ARP54779_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog".

  2. How long will it take to receive "LGALS3BP Antibody - middle region (ARP54779_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LGALS3BP Antibody - middle region (ARP54779_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "LGALS3BP Antibody - middle region (ARP54779_P050)"?

    This target may also be called "90K, M2BP, gp90, CyCAP, BTBD17B, MAC-2-BP, TANGO10B" in publications.

  5. What is the shipping cost for "LGALS3BP Antibody - middle region (ARP54779_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LGALS3BP Antibody - middle region (ARP54779_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LGALS3BP Antibody - middle region (ARP54779_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LGALS3BP Antibody - middle region (ARP54779_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LGALS3BP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LGALS3BP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LGALS3BP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LGALS3BP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LGALS3BP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LGALS3BP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LGALS3BP Antibody - middle region (ARP54779_P050)
Your Rating
We found other products you might like!