Catalog No: ARP54525_P050
Price: $0.00
SKU
ARP54525_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-LCK (ARP54525_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LCK
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%
Peptide SequenceSynthetic peptide located within the following region: PSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLE
Concentration0.5 mg/ml
Blocking PeptideFor anti-LCK (ARP54525_P050) antibody is Catalog # AAP54525 (Previous Catalog # AAPP31309)
ReferenceMerino,E., (2008) J. Immunol. 180 (9), 5805-5815
Gene SymbolLCK
Gene Full NameLymphocyte-specific protein tyrosine kinase
Alias SymbolsLSK, YT16, IMD22, p56lck, pp58lck
NCBI Gene Id3932
Protein NameTyrosine-protein kinase Lck
Description of TargetLCK is a member of the Src family of protein tyrosine kinases (PTKs). It is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. LCK localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules.This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein is a key signaling molecule in the selection and maturation of developing T-cells. It contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to the plasma membrane and pericentrosomal vesicles, and binds to cell surface receptors, including CD4 and CD8, and other signaling molecules. Multiple alternatively spliced variants, encoding the same protein, have been described.
Uniprot IDP06239
Protein Accession #NP_001036236
Nucleotide Accession #NM_001042771
Protein Size (# AA)509
Molecular Weight58kDa
Protein InteractionsLZTS2; CDKAL1; BAG6; UBC; WASL; WAS; env; SMAD3; SMAD2; MAPK1; HSP90AA1; Mbp; HAVCR2; PTPN22; G3BP1; nef; LAT; KHDRBS1; ADAM15; ZAP70; PAK2; LCK; CBL; SOCS3; SOCS2; SOCS1; IL2RB; CISH; YWHAQ; AJUBA; CD5; CBLB; SKAP1; SYK; SOS1; CD38; CD247; CD3E; FAM174A;
  1. What is the species homology for "LCK Antibody - N-terminal region (ARP54525_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".

  2. How long will it take to receive "LCK Antibody - N-terminal region (ARP54525_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "LCK Antibody - N-terminal region (ARP54525_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "LCK Antibody - N-terminal region (ARP54525_P050)"?

    This target may also be called "LSK, YT16, IMD22, p56lck, pp58lck" in publications.

  5. What is the shipping cost for "LCK Antibody - N-terminal region (ARP54525_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "LCK Antibody - N-terminal region (ARP54525_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "LCK Antibody - N-terminal region (ARP54525_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "LCK Antibody - N-terminal region (ARP54525_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "LCK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "LCK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "LCK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "LCK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "LCK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "LCK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:LCK Antibody - N-terminal region (ARP54525_P050)
Your Rating
We found other products you might like!