LAMTOR3 Antibody - N-terminal region (ARP60324_P050)

Catalog No: ARP60324_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: LAMTOR3
Sample Type: 293T Whole Cell lysates
Antibody Dilution: 1.0ug/mlLAMTOR3 is supported by BioGPS gene expression data to be expressed in HEK293T

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human LAMTOR3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-LAMTOR3 (ARP60324_P050) antibody is Catalog # AAP60324
• Sample Type Confirmation:

  LAMTOR3 is supported by BioGPS gene expression data to be expressed in HEK293T

Target Info

• Gene Symbol: LAMTOR3
• Alias Symbols: MP1, MAPBP, MAPKSP1, PRO0633, MAP2K1IP1, Ragulator3
• NCBI Gene Id: 8649
• Protein Name: Ragulator complex protein LAMTOR3
• Description of Target: This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 13.
• Uniprot ID: Q9UHA4
• Protein Accession #: NP_068805
• Nucleotide Accession #: NM_021970
• Protein Size (# AA): 124
• Molecular Weight: 13kDa
• Protein Interactions: NIF3L1; LAMTOR2; IBTK; MBD2; BHMT; PEF1; C19orf70; MRPL43; PRR3; LPCAT1; MRPS9; MRPS35; MRPL47; TOMM22; DDX28; TSR1; RNMTL1; LAMTOR1; NDUFB11; TMCO1; MRPL39; PTRH2; RAB14; MRPL51; MRPL22; UQCRQ; PUF60; RAB31; TOMM40; MSLN; TOMM70A; NUPL1; SPCS2; PICALM; V